Lineage for d1p4ka_ (1p4k A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995809Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
    automatically mapped to Pfam PF01112
  6. 2995810Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 2995824Species Flavobacterium meningosepticum [TaxId:238] [56264] (8 PDB entries)
  8. 2995831Domain d1p4ka_: 1p4k A: [87772]
    precursor D151N mutant
    complexed with gol; mutant

Details for d1p4ka_

PDB Entry: 1p4k (more details), 1.9 Å

PDB Description: crystal structure of the glycosylasparaginase precursor d151n mutant
PDB Compounds: (A:) N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase

SCOPe Domain Sequences for d1p4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ka_ d.153.1.5 (A:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Flavobacterium meningosepticum [TaxId: 238]}
ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlktsqykpivnienhntigmialdaqgnlsgacttsgmaykmhgr
vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

SCOPe Domain Coordinates for d1p4ka_:

Click to download the PDB-style file with coordinates for d1p4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1p4ka_: