Lineage for d1p42a2 (1p42 A:128-280)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401906Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 1401907Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 1401908Species Aquifex aeolicus [TaxId:63363] [89829] (10 PDB entries)
    Uniprot O67648 3-270
  8. 1401914Domain d1p42a2: 1p42 A:128-280 [87755]
    complexed with myr, zn

Details for d1p42a2

PDB Entry: 1p42 (more details), 2 Å

PDB Description: crystal structure of aquifex aeolicus lpxc deacetylase (zinc-inhibited form)
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d1p42a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p42a2 d.14.1.7 (A:128-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
vkgkfysfrgghslnvklvkelakkqk

SCOPe Domain Coordinates for d1p42a2:

Click to download the PDB-style file with coordinates for d1p42a2.
(The format of our PDB-style files is described here.)

Timeline for d1p42a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p42a1