![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (4 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries) |
![]() | Domain d1p3ob_: 1p3o B: [94050] Other proteins in same PDB: d1p3oa_, d1p3oc_, d1p3od_, d1p3oe_, d1p3og_, d1p3oh_ |
PDB Entry: 1p3o (more details), 2.75 Å
SCOP Domain Sequences for d1p3ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ob_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} vlrdniqgitkpairrlarrggakrisgliyeetrgvlkvflenvirdavtytehakrkt vtamdvvyalkrqgrtlygfgg
Timeline for d1p3ob_: