Lineage for d1p30a2 (1p30 A:637-946)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) 
duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
trimeric; in the trimers, the domains are arranged around pseudo six-fold axisFamily b.121.2.2: Adenovirus hexon [49753] (2 proteins)
each domain is heavily decorated with many insertionsProtein Adenovirus hexon [63404] (2 species) Species Human adenovirus type 5 [TaxId:28285] [49756] (3 PDB entries) 
Domain d1p30a2: 1p30 A:637-946 [93965]
Details for d1p30a2
PDB Entry: 1p30 (more details), 2.5 Å
PDB Description: refinement of adenovirus type 5 hexon with cns
PDB Compounds: (A:) hexon proteinSCOPe Domain Sequences for d1p30a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p30a2 b.121.2.2 (A:637-946) Adenovirus hexon {Human adenovirus type 5 [TaxId: 28285]}
tndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydp
yytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynva
qcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqv
gilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripfss
nfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvie
tvylrtpfsa
SCOPe Domain Coordinates for d1p30a2:
Click to download the PDB-style file with coordinates for d1p30a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p30a2:
- d1p30a2 first appeared in SCOP 1.67
- d1p30a2 appears in SCOPe 2.05
- d1p30a2 appears in SCOPe 2.07
- d1p30a2 appears in the current release, SCOPe 2.08
View in 3D
