![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) ![]() duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
![]() | Family b.121.2.2: Adenovirus hexon [49753] (2 proteins) each domain is heavily decorated with many insertions |
![]() | Protein Adenovirus hexon [63404] (2 species) |
![]() | Species Human adenovirus type 2 [TaxId:10515] [49755] (1 PDB entry) |
![]() | Domain d1p2za2: 1p2z A:651-962 [93963] complexed with cit |
PDB Entry: 1p2z (more details), 2.2 Å
SCOPe Domain Sequences for d1p2za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2za2 b.121.2.2 (A:651-962) Adenovirus hexon {Human adenovirus type 2 [TaxId: 10515]} ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgy dpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegyn vaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyq qvgilhqhnnsgfvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripf ssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgv ietvylrtpfsa
Timeline for d1p2za2: