Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Response regulator DrrB [89587] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89588] (1 PDB entry) |
Domain d1p2fa2: 1p2f A:3-120 [87721] Other proteins in same PDB: d1p2fa1, d1p2fa3 |
PDB Entry: 1p2f (more details), 1.8 Å
SCOPe Domain Sequences for d1p2fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2fa2 c.23.1.1 (A:3-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} wkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgyeic rmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrflerekk
Timeline for d1p2fa2: