Lineage for d1p2fa2 (1p2f A:3-120)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855601Protein Response regulator DrrB [89587] (1 species)
  7. 2855602Species Thermotoga maritima [TaxId:2336] [89588] (1 PDB entry)
  8. 2855603Domain d1p2fa2: 1p2f A:3-120 [87721]
    Other proteins in same PDB: d1p2fa1, d1p2fa3

Details for d1p2fa2

PDB Entry: 1p2f (more details), 1.8 Å

PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d1p2fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2fa2 c.23.1.1 (A:3-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}
wkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgyeic
rmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrflerekk

SCOPe Domain Coordinates for d1p2fa2:

Click to download the PDB-style file with coordinates for d1p2fa2.
(The format of our PDB-style files is described here.)

Timeline for d1p2fa2: