Lineage for d1p2fa1 (1p2f A:121-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308618Family a.4.6.1: PhoB-like [46895] (6 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 2308640Protein Response regulator DrrB [88988] (1 species)
  7. 2308641Species Thermotoga maritima [TaxId:2336] [88989] (1 PDB entry)
  8. 2308642Domain d1p2fa1: 1p2f A:121-217 [87720]
    Other proteins in same PDB: d1p2fa2, d1p2fa3

Details for d1p2fa1

PDB Entry: 1p2f (more details), 1.8 Å

PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d1p2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}
glydfgdlkidatgftvflkgkrihlpkkefeillflaenagkvvtreklletfwedpvs
prvvdtvikrirkaieddpnrpryiktiwgvgymftg

SCOPe Domain Coordinates for d1p2fa1:

Click to download the PDB-style file with coordinates for d1p2fa1.
(The format of our PDB-style files is described here.)

Timeline for d1p2fa1: