Lineage for d1p2fa1 (1p2f A:121-217)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY familyFamily a.4.6.1: PhoB-like [46895] (5 proteins)
contains 4-stranded meander beta-sheet in the N-terminal extension
Protein Response regulator DrrB [88988] (1 species) Species Thermotoga maritima [TaxId:2336] [88989] (1 PDB entry) 
Domain d1p2fa1: 1p2f A:121-217 [87720]
Other proteins in same PDB: d1p2fa2
Details for d1p2fa1
PDB Entry: 1p2f (more details), 1.8 Å
PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
PDB Compounds: (A:) Response regulatorSCOPe Domain Sequences for d1p2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}
glydfgdlkidatgftvflkgkrihlpkkefeillflaenagkvvtreklletfwedpvs
prvvdtvikrirkaieddpnrpryiktiwgvgymftg
SCOPe Domain Coordinates for d1p2fa1:
Click to download the PDB-style file with coordinates for d1p2fa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p2fa1:
- d1p2fa1 first appeared in SCOP 1.65
- d1p2fa1 appears in SCOPe 2.02
- d1p2fa1 appears in SCOPe 2.04
- d1p2fa1 appears in the current release, SCOPe 2.08
View in 3D
