![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein RNA-binding protein 8 [89938] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries) RBM8A, Y14 |
![]() | Domain d1p27b_: 1p27 B: [93908] Other proteins in same PDB: d1p27a_, d1p27c_ protein/RNA complex |
PDB Entry: 1p27 (more details), 2 Å
SCOPe Domain Sequences for d1p27b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p27b_ d.58.7.1 (B:) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]} pgpqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyet ykeaqaameglngqdlmgqpisvdwcfvrgpp
Timeline for d1p27b_: