Lineage for d1p27b_ (1p27 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028212Protein RNA-binding protein 8 [89938] (2 species)
  7. 1028218Species Human (Homo sapiens) [TaxId:9606] [102978] (3 PDB entries)
    RBM8A, Y14
  8. 1028219Domain d1p27b_: 1p27 B: [93908]
    Other proteins in same PDB: d1p27a_, d1p27c_
    protein/RNA complex

Details for d1p27b_

PDB Entry: 1p27 (more details), 2 Å

PDB Description: Crystal Structure of the Human Y14/Magoh complex
PDB Compounds: (B:) RNA-binding protein 8A

SCOPe Domain Sequences for d1p27b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p27b_ d.58.7.1 (B:) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pgpqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyet
ykeaqaameglngqdlmgqpisvdwcfvrgpp

SCOPe Domain Coordinates for d1p27b_:

Click to download the PDB-style file with coordinates for d1p27b_.
(The format of our PDB-style files is described here.)

Timeline for d1p27b_: