Lineage for d1p1xa_ (1p1x A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097020Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2097027Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
    Uniprot P00882
  8. 2097028Domain d1p1xa_: 1p1x A: [104060]
    Other proteins in same PDB: d1p1xb2

Details for d1p1xa_

PDB Entry: 1p1x (more details), 0.99 Å

PDB Description: comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1p1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

SCOPe Domain Coordinates for d1p1xa_:

Click to download the PDB-style file with coordinates for d1p1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1p1xa_: