Lineage for d1p1ma2 (1p1m A:50-330)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
automatically mapped to Pfam PF01979Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species) Species Thermotoga maritima [TaxId:2336] [82260] (3 PDB entries) 
Domain d1p1ma2: 1p1m A:50-330 [87697]
Other proteins in same PDB: d1p1ma1
structural genomics
complexed with met, ni
Details for d1p1ma2
PDB Entry: 1p1m (more details), 1.5 Å
PDB Description: structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
PDB Compounds: (A:) Hypothetical protein TM0936SCOPe Domain Sequences for d1p1ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]}
alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia
gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg
fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc
vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl
ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg
SCOPe Domain Coordinates for d1p1ma2:
Click to download the PDB-style file with coordinates for d1p1ma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p1ma2:
- d1p1ma2 first appeared in SCOP 1.65
- d1p1ma2 appears in SCOPe 2.05
- d1p1ma2 appears in SCOPe 2.07
- d1p1ma2 appears in the current release, SCOPe 2.08
View in 3D
