Lineage for d1p17b_ (1p17 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. Protein Hypoxanthine PRTase [53286] (4 species)
  7. Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
    Uniprot Q27796
  8. Domain d1p17b_: 1p17 B: [104050]
    complexed with imp; mutant

Details for d1p17b_

PDB Entry: 1p17 (more details), 2.7 Å

PDB Description: Hypoxanthine Phosphoribosyltransferase from Trypanosoma cruzi, K68R mutant, complexed with the product IMP
PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1p17b_:

Sequence, based on SEQRES records: (download)

>d1p17b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
cralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltln
ylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrd
ivvlrpevyaereaarqkkqraigsadtdr

Sequence, based on observed residues (ATOM records): (download)

>d1p17b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
cralcdfnvpvrmeficvssysgqvrmlldtrhsieghhvlivedivdtaltlnylyhmy
ftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrp
evyaereaarqkkqraigsadtdr

SCOPe Domain Coordinates for d1p17b_ are not available.

Timeline for d1p17b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p17a_, d1p17c_, d1p17d_