Lineage for d1ozpa_ (1ozp A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731186Protein Mycothiol synthase MshD [103175] (1 species)
    duplication: consists of two NAT domains swapped with the C-terminal strands with both domains binding acetyl-CoA; structural link with the other families
  7. 731187Species Mycobacterium tuberculosis [TaxId:1773] [103176] (3 PDB entries)
    Rv0819
  8. 731189Domain d1ozpa_: 1ozp A: [93853]
    complexed with aco

Details for d1ozpa_

PDB Entry: 1ozp (more details), 1.7 Å

PDB Description: Crystal Structure of Rv0819 from Mycobacterium tuberculosis MshD-Mycothiol Synthase Acetyl-Coenzyme A Complex.
PDB Compounds: (A:) hypothetical protein Rv0819

SCOP Domain Sequences for d1ozpa_:

Sequence, based on SEQRES records: (download)

>d1ozpa_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
aldwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpii
gylnlspprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparata
salglvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqgg
wtavqlaerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdp
aaqrrglgqmltsigivslarrlggrktldpavepavllyvesdnvaavrtyqslgftty
svdtayal

Sequence, based on observed residues (ATOM records): (download)

>d1ozpa_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}
aldwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpii
gylnlsppggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasal
glvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwta
vqlaerrgeawfdpdglilafgdgrllgfhwtkvhpdhpglgevyvlgvdpaaqrrglgq
mltsigivslarrlvepavllyvesdnvaavrtyqslgfttysvdtayal

SCOP Domain Coordinates for d1ozpa_:

Click to download the PDB-style file with coordinates for d1ozpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ozpa_: