Lineage for d1oy5a_ (1oy5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528542Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2528543Protein tRNA(m1G37)-methyltransferase TrmD [89630] (3 species)
  7. 2528544Species Aquifex aeolicus [TaxId:63363] [102278] (1 PDB entry)
  8. 2528545Domain d1oy5a_: 1oy5 A: [93718]
    a TrmD topoisomer that lacks the knot; misfolded inactive structure?

Details for d1oy5a_

PDB Entry: 1oy5 (more details), 2.6 Å

PDB Description: Crystal structure of tRNA (m1G37) methyltransferase from Aquifex aeolicus
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d1oy5a_:

Sequence, based on SEQRES records: (download)

>d1oy5a_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Aquifex aeolicus [TaxId: 63363]}
nplrffvltifphiiscyseygivkqaikkgkvevypidlrefapkgqvddvpygglpgm
vlkpepiyeaydyvvenygkpfvlitepwgeklnqklvnelskkerimiicgryegvder
vkkivdmeislgdfilsggeivalavidavsrvlpgvlsepqsiqedsfqnrwlgypvyt
rpreyrgmkvpeellsghhklielwklwhrientvkkrpdlipkdltelekd

Sequence, based on observed residues (ATOM records): (download)

>d1oy5a_ c.116.1.4 (A:) tRNA(m1G37)-methyltransferase TrmD {Aquifex aeolicus [TaxId: 63363]}
nplrffvltifphiiscyseygivkqaikkgkvevypidlrefapkgqvddvpygglpgm
vlkpepiyeaydyvvenygkpfvlitepwgeklnqklvnelskkerimiicgryegvder
vkkivdmeislgdfilsggeivalavidavsrvlpgvlsepypvytrpreyrgmkvpeel
lsghhklielwklwhrientvkkrpdlipkdltelekd

SCOPe Domain Coordinates for d1oy5a_:

Click to download the PDB-style file with coordinates for d1oy5a_.
(The format of our PDB-style files is described here.)

Timeline for d1oy5a_: