Lineage for d1ox0a1 (1ox0 A:-5-251)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 846960Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 847167Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)
  7. 847181Species Streptococcus pneumoniae [TaxId:1313] [89793] (3 PDB entries)
  8. 847182Domain d1ox0a1: 1ox0 A:-5-251 [87495]

Details for d1ox0a1

PDB Entry: 1ox0 (more details), 1.3 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae
PDB Compounds: (A:) Beta ketoacyl-acyl carrier protein synthase

SCOP Domain Sequences for d1ox0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]}
prgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiq
dfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikei
edqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdaf
rsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegs
gmlvleslehaekrga

SCOP Domain Coordinates for d1ox0a1:

Click to download the PDB-style file with coordinates for d1ox0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ox0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ox0a2