Lineage for d1owta_ (1owt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2614080Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) (S)
    automatically mapped to Pfam PF12924
  5. 2614081Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 2614082Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 2614083Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 2614097Domain d1owta_: 1owt A: [87493]

Details for d1owta_

PDB Entry: 1owt (more details)

PDB Description: structure of the alzheimer's disease amyloid precursor protein copper binding domain
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d1owta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owta_ d.230.3.1 (A:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
sdallvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgve
fvccpl

SCOPe Domain Coordinates for d1owta_:

Click to download the PDB-style file with coordinates for d1owta_.
(The format of our PDB-style files is described here.)

Timeline for d1owta_: