Lineage for d1owsb_ (1ows B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068Protein Snake phospholipase A2 [48624] (36 species) 
Species Indian cobra (Naja naja), isoform 3 [TaxId:35670] [89167] (1 PDB entry) 
Domain d1owsb_: 1ows B: [87492]
zinc containing heterodimer of two different isoforms
complexed with nag, zn
Details for d1owsb_
PDB Entry: 1ows (more details), 2.3 Å
PDB Description: crystal structure of a c49 phospholipase a2 from indian cobra reveals carbohydrate binding in the hydrophobic channel
PDB Compounds: (B:) phospholipase a2SCOPe Domain Sequences for d1owsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owsb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian cobra (Naja naja), isoform 3 [TaxId: 35670]}
nikqfnnmiectvparswwdfadygcycgsgsgsptddldrccqthdncygagggstgca
pksrtytyqcsqgtltcsgensacaattcdcdrlaaicfagapyndtnynidlksrcq
SCOPe Domain Coordinates for d1owsb_:
Click to download the PDB-style file with coordinates for d1owsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1owsb_:
- d1owsb_ first appeared in SCOP 1.65
- d1owsb_ appears in SCOPe 2.04
- d1owsb_ appears in SCOPe 2.06
- d1owsb_ appears in the current release, SCOPe 2.08
View in 3D
