Lineage for d1owqa2 (1owq A:240-307)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
secreted during involution
Species Cow (Bos taurus) [TaxId:9913] [110872] (2 PDB entries)
Uniprot P30922
Domain d1owqa2: 1owq A:240-307 [104042]
Other proteins in same PDB: d1owqa1
Details for d1owqa2
PDB Entry: 1owq (more details), 2 Å
PDB Description: crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
PDB Compounds: (A:) signal processing proteinSCOPe Domain Sequences for d1owqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owqa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]}
fgrsytlassktdvgapisgpgipgqftkekgtlayyeicdflhgatthrfrdqqvpyat
kgnqwvay
SCOPe Domain Coordinates for d1owqa2:
Click to download the PDB-style file with coordinates for d1owqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1owqa2:
- d1owqa2 first appeared in SCOP 1.69
- d1owqa2 appears in SCOPe 2.04
- d1owqa2 appears in SCOPe 2.06
- d1owqa2 appears in the current release, SCOPe 2.08
View in 3D
