Lineage for d1owqa1 (1owq A:1-239,A:308-361)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Cow (Bos taurus) [TaxId:9913] [110352] (2 PDB entries)
Uniprot P30922
Domain d1owqa1: 1owq A:1-239,A:308-361 [104041]
Other proteins in same PDB: d1owqa2
Details for d1owqa1
PDB Entry: 1owq (more details), 2 Å
PDB Description: crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
PDB Compounds: (A:) signal processing proteinSCOPe Domain Sequences for d1owqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owqa1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgserfskiasktqsrrtfiksvppflrthgfdgldlawly
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavpagkiaidrgydiaqisrhldfi
slltydfhggwrgtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
SCOPe Domain Coordinates for d1owqa1:
Click to download the PDB-style file with coordinates for d1owqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1owqa1:
- d1owqa1 first appeared in SCOP 1.69
- d1owqa1 appears in SCOPe 2.07
View in 3D
