Lineage for d1ow6a_ (1ow6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700417Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 2700418Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 2700419Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 2700424Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)
  8. 2700429Domain d1ow6a_: 1ow6 A: [93631]
    complexed with paxillin ld4 motif, chains D and F

Details for d1ow6a_

PDB Entry: 1ow6 (more details), 2.35 Å

PDB Description: paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1ow6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow6a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
nldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipll
pasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknll
dvidqarlkmlgqt

SCOPe Domain Coordinates for d1ow6a_:

Click to download the PDB-style file with coordinates for d1ow6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow6a_: