Lineage for d1ovna2 (1ovn A:24-145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485304Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
    automatically mapped to Pfam PF07912
  6. Protein Windbeutel, N-terminal domain [102444] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102445] (1 PDB entry)
  8. 2485310Domain d1ovna2: 1ovn A:24-145 [93603]
    Other proteins in same PDB: d1ovna1, d1ovnb1
    complexed with cs

Details for d1ovna2

PDB Entry: 1ovn (more details), 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein
PDB Compounds: (A:) Windbeutel

SCOPe Domain Sequences for d1ovna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovna2 c.47.1.7 (A:24-145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

SCOPe Domain Coordinates for d1ovna2:

Click to download the PDB-style file with coordinates for d1ovna2.
(The format of our PDB-style files is described here.)

Timeline for d1ovna2:

2485310
d1ovna2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ovna1