Lineage for d1ovna1 (1ovn A:146-252)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739455Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 1739456Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 1739457Family a.71.1.1: ERP29 C domain-like [47934] (2 proteins)
  6. Protein Windbeutel, C-terminal domain [101269] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101270] (1 PDB entry)
  8. 1739463Domain d1ovna1: 1ovn A:146-252 [93602]
    Other proteins in same PDB: d1ovna2, d1ovnb2
    complexed with cs

Details for d1ovna1

PDB Entry: 1ovn (more details), 1.9 Å

PDB Description: crystal structure and functional analysis of drosophila wind-- a pdi- related protein
PDB Compounds: (A:) Windbeutel

SCOPe Domain Sequences for d1ovna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovna1 a.71.1.1 (A:146-252) Windbeutel, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihevg
ydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktap

SCOPe Domain Coordinates for d1ovna1:

Click to download the PDB-style file with coordinates for d1ovna1.
(The format of our PDB-style files is described here.)

Timeline for d1ovna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ovna2