Lineage for d1ovea_ (1ove A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735287Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 735288Species Human (Homo sapiens) [TaxId:9606] [56130] (41 PDB entries)
  8. 735295Domain d1ovea_: 1ove A: [93595]
    complexed with 358, gol; mutant

Details for d1ovea_

PDB Entry: 1ove (more details), 2.1 Å

PDB Description: the structure of p38 alpha in complex with a dihydroquinolinone
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOP Domain Sequences for d1ovea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovea_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOP Domain Coordinates for d1ovea_:

Click to download the PDB-style file with coordinates for d1ovea_.
(The format of our PDB-style files is described here.)

Timeline for d1ovea_: