Lineage for d1ov3a1 (1ov3 A:150-214)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796374Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 796375Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 796380Domain d1ov3a1: 1ov3 A:150-214 [87451]
    N-terminal domain forms a segment-swapped dimer; C-terminal domain binds a peptide from p22phox, chains C and D

Details for d1ov3a1

PDB Entry: 1ov3 (more details), 1.8 Å

PDB Description: structure of the p22phox-p47phox complex
PDB Compounds: (A:) neutrophil cytosol factor 1

SCOP Domain Sequences for d1ov3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ov3a1 b.34.2.1 (A:150-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
lgspefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasf
lepld

SCOP Domain Coordinates for d1ov3a1:

Click to download the PDB-style file with coordinates for d1ov3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ov3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ov3a2