![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (39 proteins) |
![]() | Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries) |
![]() | Domain d1ov3a1: 1ov3 A:150-214 [87451] N-terminal domain forms a segment-swapped dimer; C-terminal domain binds a peptide from p22phox, chains C and D |
PDB Entry: 1ov3 (more details), 1.8 Å
SCOP Domain Sequences for d1ov3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ov3a1 b.34.2.1 (A:150-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} lgspefiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasf lepld
Timeline for d1ov3a1: