Lineage for d1ouwb_ (1ouw B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137196Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1137214Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1137215Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 1137244Protein Calystegia sepium agglutinin [101948] (1 species)
  7. 1137245Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (1 PDB entry)
  8. 1137247Domain d1ouwb_: 1ouw B: [93572]
    complexed with edo, imd, mlt

Details for d1ouwb_

PDB Entry: 1ouw (more details), 1.37 Å

PDB Description: Crystal structure of Calystegia sepium agglutinin
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1ouwb_:

Sequence, based on SEQRES records: (download)

>d1ouwb_ b.77.3.1 (B:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrhk

Sequence, based on observed residues (ATOM records): (download)

>d1ouwb_ b.77.3.1 (B:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkgskdtitvgg
ggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpfs
sanvvgneivgflgrsgyyvdaigtynrhk

SCOPe Domain Coordinates for d1ouwb_:

Click to download the PDB-style file with coordinates for d1ouwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ouwb_: