Lineage for d1oupa_ (1oup A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structuresSuperfamily d.4.1: His-Me finger endonucleases [54060] (7 families) 
common motif contains conserved histidine residue and metal-binding site
Family d.4.1.6: Endonuclease I [102726] (2 proteins)
automatically mapped to Pfam PF04231
Protein Periplasmic endonuclease Vvn [102727] (1 species) Species Vibrio vulnificus [TaxId:672] [102728] (2 PDB entries) 
Domain d1oupa_: 1oup A: [93555]
complexed with DNA
protein/DNA complex; complexed with ca
Details for d1oupa_
PDB Entry: 1oup (more details), 2.3 Å
PDB Description: crystal structure of the periplasmic endonuclease vvn complexed with octamer double stranded dna
PDB Compounds: (A:) NucleaseSCOPe Domain Sequences for d1oupa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oupa_ d.4.1.6 (A:) Periplasmic endonuclease Vvn {Vibrio vulnificus [TaxId: 672]}
appssfsaakqqavkiyqdhpisfycgcdiewqgkkgipnletcgyqvrkqqtrasriew
eavvpawqfghhrqcwqkggrkncskndqqfrlmeadlhnltpaigevngdrsnfnfsqw
ngvdgvsygrcemqvnfkqrkvmppdrargsiartylymsqeygfqlskqqqqlmqawnk
sypvdewectrddriakiqgnhnpfvqqscqtq
SCOPe Domain Coordinates for d1oupa_:
Click to download the PDB-style file with coordinates for d1oupa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oupa_:
- d1oupa_ first appeared in SCOP 1.67
- d1oupa_ appears in SCOPe 2.05
- d1oupa_ appears in SCOPe 2.07
- d1oupa_ appears in the current release, SCOPe 2.08
View in 3D
