Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.6: Endonuclease I [102726] (2 proteins) automatically mapped to Pfam PF04231 |
Protein Periplasmic endonuclease Vvn [102727] (1 species) |
Species Vibrio vulnificus [TaxId:672] [102728] (2 PDB entries) |
Domain d1oupa_: 1oup A: [93555] complexed with DNA protein/DNA complex; complexed with ca |
PDB Entry: 1oup (more details), 2.3 Å
SCOPe Domain Sequences for d1oupa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oupa_ d.4.1.6 (A:) Periplasmic endonuclease Vvn {Vibrio vulnificus [TaxId: 672]} appssfsaakqqavkiyqdhpisfycgcdiewqgkkgipnletcgyqvrkqqtrasriew eavvpawqfghhrqcwqkggrkncskndqqfrlmeadlhnltpaigevngdrsnfnfsqw ngvdgvsygrcemqvnfkqrkvmppdrargsiartylymsqeygfqlskqqqqlmqawnk sypvdewectrddriakiqgnhnpfvqqscqtq
Timeline for d1oupa_: