![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (52 PDB entries) Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1 |
![]() | Domain d1otsd1: 1ots D:1-106 [87419] Other proteins in same PDB: d1otsa_, d1otsb_, d1otsc1, d1otsc2, d1otsd2, d1otse1, d1otse2, d1otsf2 part of anti-CLC chloride channel Fab complexed with cl |
PDB Entry: 1ots (more details), 2.51 Å
SCOPe Domain Sequences for d1otsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otsd1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil
Timeline for d1otsd1: