Lineage for d1ot6a_ (1ot6 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427979Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1427980Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 1427981Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 1427982Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (61 PDB entries)
    Uniprot P16113
  8. 1427985Domain d1ot6a_: 1ot6 A: [93504]
    complexed with hc4; mutant

Details for d1ot6a_

PDB Entry: 1ot6 (more details), 0.95 Å

PDB Description: cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1ot6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot6a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d1ot6a_:

Click to download the PDB-style file with coordinates for d1ot6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ot6a_: