Lineage for d1os1a2 (1os1 A:4-227)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domainSuperfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) 
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) 
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) Species Escherichia coli [TaxId:562] [68926] (10 PDB entries) 
Domain d1os1a2: 1os1 A:4-227 [93468]
Other proteins in same PDB: d1os1a1
complexed with atp, ca, mg, pyr
Details for d1os1a2
PDB Entry: 1os1 (more details), 1.8 Å
PDB Description: Structure of Phosphoenolpyruvate Carboxykinase complexed with ATP,Mg, Ca and pyruvate.
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]SCOPe Domain Sequences for d1os1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1os1a2 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
SCOPe Domain Coordinates for d1os1a2:
Click to download the PDB-style file with coordinates for d1os1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1os1a2:
- d1os1a2 first appeared in SCOP 1.67
- d1os1a2 appears in SCOPe 2.06
- d1os1a2 appears in the current release, SCOPe 2.08
View in 3D
