![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) ![]() automatically mapped to Pfam PF00930 |
![]() | Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
![]() | Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries) |
![]() | Domain d1orva1: 1orv A:39-508 [87354] Other proteins in same PDB: d1orva2, d1orvb2, d1orvc2, d1orvd2 complexed with nag, so4 |
PDB Entry: 1orv (more details), 1.8 Å
SCOPe Domain Sequences for d1orva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orva1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq
Timeline for d1orva1: