Lineage for d1orsa1 (1ors A:1-107)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries) 
Domain d1orsa1: 1ors A:1-107 [87349]
Other proteins in same PDB: d1orsa2, d1orsb1, d1orsb2, d1orsc_
part of anti-VD potassium channel KVAP Fab 33H1
Details for d1orsa1
PDB Entry: 1ors (more details), 1.9 Å
PDB Description: x-ray structure of the kvap potassium channel voltage sensor in complex with an fab
PDB Compounds: (A:) 33H1 Fab light chainSCOPe Domain Sequences for d1orsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orsa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkleik
SCOPe Domain Coordinates for d1orsa1:
Click to download the PDB-style file with coordinates for d1orsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1orsa1:
- d1orsa1 first appeared in SCOP 1.65
- d1orsa1 appears in SCOP 1.75
- d1orsa1 appears in SCOPe 2.02
- d1orsa1 appears in the current release, SCOPe 2.08
View in 3D
