Lineage for d1oria_ (1ori A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892984Protein Protein arginine N-methyltransferase 1, PRMT1 [89749] (1 species)
  7. 2892985Species Norway rat (Rattus norvegicus) [TaxId:10116] [89750] (3 PDB entries)
  8. 2892986Domain d1oria_: 1ori A: [87339]
    complexed with sah, unl

Details for d1oria_

PDB Entry: 1ori (more details), 2.5 Å

PDB Description: Structure of the predominant protein arginine methyltransferase PRMT1
PDB Compounds: (A:) Protein arginine N-methyltransferase 1

SCOPe Domain Sequences for d1oria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
syahfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagarkvi
giecssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyesmln
tvlhardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaikep
lvdvvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieftrc
hkrtgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidldf
kgqlcelscstdyrmr

SCOPe Domain Coordinates for d1oria_:

Click to download the PDB-style file with coordinates for d1oria_.
(The format of our PDB-style files is described here.)

Timeline for d1oria_: