Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Caltractin (centrin 2) [89053] (2 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [89055] (1 PDB entry) |
Domain d1oqpa_: 1oqp A: [87319] complexed with the cdc31p-binding domain (peptide) from kar1p, chain B |
PDB Entry: 1oqp (more details)
SCOPe Domain Sequences for d1oqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gsgerdsreeilkafrlfdddnsgtitikdlrrvakelgenlteeelqemiaeadrnddn eidedefirimkktslf
Timeline for d1oqpa_: