Lineage for d1oqpa_ (1oqp A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490206Protein Caltractin (centrin 2) [89053] (2 species)
  7. 1490207Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [89055] (1 PDB entry)
  8. 1490208Domain d1oqpa_: 1oqp A: [87319]
    complexed with the cdc31p-binding domain (peptide) from kar1p, chain B

Details for d1oqpa_

PDB Entry: 1oqp (more details)

PDB Description: structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
PDB Compounds: (A:) Caltractin

SCOPe Domain Sequences for d1oqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gsgerdsreeilkafrlfdddnsgtitikdlrrvakelgenlteeelqemiaeadrnddn
eidedefirimkktslf

SCOPe Domain Coordinates for d1oqpa_:

Click to download the PDB-style file with coordinates for d1oqpa_.
(The format of our PDB-style files is described here.)

Timeline for d1oqpa_: