Lineage for d1oqfa_ (1oqf A:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) 
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
forms a swapped dimerProtein 2-methylisocitrate lyase [89499] (2 species) Species Escherichia coli [TaxId:562] [89500] (4 PDB entries) 
Domain d1oqfa_: 1oqf A: [93415]
Details for d1oqfa_
PDB Entry: 1oqf (more details), 1.93 Å
PDB Description: Crystal structure of the 2-methylisocitrate lyase
PDB Compounds: (A:) 2-methylisocitrate lyaseSCOPe Domain Sequences for d1oqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqfa_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]}
slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
SCOPe Domain Coordinates for d1oqfa_:
Click to download the PDB-style file with coordinates for d1oqfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oqfa_:
- d1oqfa_ first appeared in SCOP 1.67
- d1oqfa_ appears in SCOPe 2.01
- d1oqfa_ appears in SCOPe 2.03
- d1oqfa_ appears in the current release, SCOPe 2.08
View in 3D
