Lineage for d1opka2 (1opk A:140-240)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2571843Protein Abl tyrosine kinase [55581] (2 species)
  7. 2571848Species Mouse (Mus musculus) [TaxId:10090] [89998] (1 PDB entry)
  8. 2571849Domain d1opka2: 1opk A:140-240 [87233]
    Other proteins in same PDB: d1opka1, d1opka3
    complexed with gol, myr, p16

Details for d1opka2

PDB Entry: 1opk (more details), 1.8 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d1opka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

SCOPe Domain Coordinates for d1opka2:

Click to download the PDB-style file with coordinates for d1opka2.
(The format of our PDB-style files is described here.)

Timeline for d1opka2: