Lineage for d1op9a_ (1op9 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929315Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 929316Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 929330Domain d1op9a_: 1op9 A: [93398]
    Other proteins in same PDB: d1op9b_
    anti-lysozyme Hl6 VHh domain

Details for d1op9a_

PDB Entry: 1op9 (more details), 1.86 Å

PDB Description: complex of human lysozyme with camelid vhh hl6 antibody fragment
PDB Compounds: (A:) HL6 camel VHH fragment

SCOPe Domain Sequences for d1op9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op9a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads
vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs
s

SCOPe Domain Coordinates for d1op9a_:

Click to download the PDB-style file with coordinates for d1op9a_.
(The format of our PDB-style files is described here.)

Timeline for d1op9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1op9b_