Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Venom serine protease [50570] (2 species) |
Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [110238] (2 PDB entries) Uniprot Q9I8X1 |
Domain d1op2a_: 1op2 A: [104020] complexed with nag, so4 |
PDB Entry: 1op2 (more details), 2.1 Å
SCOPe Domain Sequences for d1op2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op2a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} viggnecdinehrflvaffnttgffcggtlinpewvvtaahcdstnfqmqlgvhskkvln edeqtrnpkekficpnknnnevldkdimlikldkpisnskhiaplslpssppsvgsvcri mgwgsitpvketfpdvpycaninlldhavcqagypellaeyrtlcagivqggkdtcggds ggplicngqfqgivsygahpcgqgpkpgiytnvfdytdwiqrniagntdatcpp
Timeline for d1op2a_: