Lineage for d1ooza1 (1ooz A:260-481)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) 
Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the restProtein Succinate:CoA transferase, C-terminal domain [82466] (2 species) Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries) 
Domain d1ooza1: 1ooz A:260-481 [93392]
Other proteins in same PDB: d1ooza2, d1oozb2
complexed with k; mutant
Details for d1ooza1
PDB Entry: 1ooz (more details), 2.1 Å
PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (A:) succinyl-coa:3-ketoacid-coenzyme a transferaseSCOPe Domain Sequences for d1ooza1:
Sequence, based on SEQRES records: (download)
>d1ooza1 c.124.1.3 (A:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk
lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv
drkkgltlielwegltvddikkstgcdfavspklipmqqvtt
Sequence, based on observed residues (ATOM records): (download)
>d1ooza1 c.124.1.3 (A:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmvkgm
ggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdrkkg
ltlielwegltvddikkstgcdfavspklipmqqvtt
SCOPe Domain Coordinates for d1ooza1:
Click to download the PDB-style file with coordinates for d1ooza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ooza1:
- d1ooza1 first appeared in SCOP 1.67
- d1ooza1 appears in SCOPe 2.07
View in 3D
