Lineage for d1oota_ (1oot A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783126Protein Hypothetical protein YFR024c [101679] (1 species)
  7. 2783127Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101680] (1 PDB entry)
  8. 2783128Domain d1oota_: 1oot A: [93386]
    structural genomics; C-terminal domain
    complexed with cl

Details for d1oota_

PDB Entry: 1oot (more details), 1.39 Å

PDB Description: Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution
PDB Compounds: (A:) Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region

SCOPe Domain Sequences for d1oota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

SCOPe Domain Coordinates for d1oota_:

Click to download the PDB-style file with coordinates for d1oota_.
(The format of our PDB-style files is described here.)

Timeline for d1oota_: