Lineage for d1ooha_ (1ooh A:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) 
the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavityFamily a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins) Protein Odorant binding protein LUSH [101190] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (6 PDB entries) 
Domain d1ooha_: 1ooh A: [93383]
Details for d1ooha_
PDB Entry: 1ooh (more details), 1.25 Å
PDB Description: Complex of Drosophila odorant binding protein LUSH with butanol
PDB Compounds: (A:) odorant binding protein LUSHSCOP Domain Sequences for d1ooha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ooha_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
gqfmwp
SCOP Domain Coordinates for d1ooha_:
Click to download the PDB-style file with coordinates for d1ooha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ooha_:
- d1ooha_ first appeared in SCOP 1.67
- d1ooha_ appears in SCOP 1.71
- d1ooha_ appears in SCOP 1.75
- d1ooha_ appears in the current release, SCOPe 2.08, called d1ooha1
View in 3D
