Lineage for d1oo0b_ (1oo0 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein RNA-binding protein 8 [89938] (2 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
CG8781 protein
Domain d1oo0b_: 1oo0 B: [87183]
Other proteins in same PDB: d1oo0a_
protein/RNA complex; complexed with bme, gol, mpd, sr
Details for d1oo0b_
PDB Entry: 1oo0 (more details), 1.85 Å
PDB Description: Crystal structure of the Drosophila Mago nashi-Y14 complex
PDB Compounds: (B:) cg8781-paSCOPe Domain Sequences for d1oo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oo0b_ d.58.7.1 (B:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
hkqalaakealngaeimgqtiqvdwcfvkgpk
SCOPe Domain Coordinates for d1oo0b_:
Click to download the PDB-style file with coordinates for d1oo0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oo0b_:
- d1oo0b_ first appeared in SCOP 1.65
- d1oo0b_ appears in SCOPe 2.07
View in 3D
