Lineage for d1onc__ (1onc -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597438Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 597439Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 597440Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 597441Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 597455Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (2 PDB entries)
  8. 597456Domain d1onc__: 1onc - [37278]
    complexed with so4

Details for d1onc__

PDB Entry: 1onc (more details), 1.7 Å

PDB Description: the refined 1.7 angstroms x-ray crystallographic structure of p-30, an amphibian ribonuclease with anti-tumor activity

SCOP Domain Sequences for d1onc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onc__ d.5.1.1 (-) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOP Domain Coordinates for d1onc__:

Click to download the PDB-style file with coordinates for d1onc__.
(The format of our PDB-style files is described here.)

Timeline for d1onc__: