Lineage for d1on2a2 (1on2 A:63-136)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740321Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1740322Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 1740323Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 1740384Protein Manganese transport regulator MntR [89086] (1 species)
  7. 1740385Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 1740388Domain d1on2a2: 1on2 A:63-136 [87104]
    Other proteins in same PDB: d1on2a1, d1on2b1
    complexed with mn; mutant

Details for d1on2a2

PDB Entry: 1on2 (more details), 1.61 Å

PDB Description: bacillus subtilis manganese transport regulator (mntr), d8m mutant, bound to manganese
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d1on2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on2a2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOPe Domain Coordinates for d1on2a2:

Click to download the PDB-style file with coordinates for d1on2a2.
(The format of our PDB-style files is described here.)

Timeline for d1on2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on2a1