![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Recoverin [47533] (1 species) Calcium-myristoyl switch; only one EF-hand is functional |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries) |
![]() | Domain d1omra_: 1omr A: [93349] complexed with ca |
PDB Entry: 1omr (more details), 1.5 Å
SCOPe Domain Sequences for d1omra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke ilrliqfepqkvkeklkekkl
Timeline for d1omra_: