Lineage for d1omia2 (1omi A:1138-1237)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 634956Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)
  6. 634998Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species)
  7. 634999Species Bacteria (Listeria monocytogenes) [TaxId:1639] [88976] (3 PDB entries)
  8. 635010Domain d1omia2: 1omi A:1138-1237 [87080]
    Other proteins in same PDB: d1omia1, d1omib1

Details for d1omia2

PDB Entry: 1omi (more details), 2.8 Å

PDB Description: crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
PDB Compounds: (A:) listeriolysin regulatory protein

SCOP Domain Sequences for d1omia2:

Sequence, based on SEQRES records: (download)

>d1omia2 a.4.5.4 (A:1138-1237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

Sequence, based on observed residues (ATOM records): (download)

>d1omia2 a.4.5.4 (A:1138-1237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicgqlliltyvygketpdgikitldnltmqelsavsriisklkqekvivyknscf
yvqnldylkryapkldewfylacpatwgkln

SCOP Domain Coordinates for d1omia2:

Click to download the PDB-style file with coordinates for d1omia2.
(The format of our PDB-style files is described here.)

Timeline for d1omia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1omia1