Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins) |
Domain d1omia1: 1omi A:1005-1137 [87079] Other proteins in same PDB: d1omia2, d1omib2 complexed with gol |
PDB Entry: 1omi (more details), 2.8 Å
SCOPe Domain Sequences for d1omia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omia1 b.82.3.3 (A:1005-1137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]} gsefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyyk gafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqv syslakfndfsin
Timeline for d1omia1: