Lineage for d1omia1 (1omi A:1005-1137)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331405Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1331592Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (1 protein)
  6. 1331593Protein Listeriolysin regulatory protein PrfA, N-terminal domain [89420] (1 species)
  7. 1331594Species Listeria monocytogenes [TaxId:1639] [89421] (3 PDB entries)
  8. 1331605Domain d1omia1: 1omi A:1005-1137 [87079]
    Other proteins in same PDB: d1omia2, d1omib2
    complexed with gol

Details for d1omia1

PDB Entry: 1omi (more details), 2.8 Å

PDB Description: crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
PDB Compounds: (A:) listeriolysin regulatory protein

SCOPe Domain Sequences for d1omia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omia1 b.82.3.3 (A:1005-1137) Listeriolysin regulatory protein PrfA, N-terminal domain {Listeria monocytogenes [TaxId: 1639]}
gsefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqyyk
gafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqv
syslakfndfsin

SCOPe Domain Coordinates for d1omia1:

Click to download the PDB-style file with coordinates for d1omia1.
(The format of our PDB-style files is described here.)

Timeline for d1omia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1omia2