Lineage for d1om9a_ (1om9 A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) 
contains an additional N-terminal strand
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
consist of a single subdomain
automatically mapped to Pfam PF02883
Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89202] (2 PDB entries) 
Domain d1om9a_: 1om9 A: [87077]
complexed with the p56 binding peptide; chains P and Q
Details for d1om9a_
PDB Entry: 1om9 (more details), 2.5 Å
PDB Description: Structure of the GGA1-appendage in complex with the p56 binding peptide
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1SCOPe Domain Sequences for d1om9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1om9a_ b.1.10.2 (A:) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
asitvplesikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirn
ivfqsavpkvmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmg
dqtynemgdvdqfpppetwgsl
SCOPe Domain Coordinates for d1om9a_:
Click to download the PDB-style file with coordinates for d1om9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1om9a_:
- d1om9a_ first appeared in SCOP 1.65
- d1om9a_ appears in SCOPe 2.06
- d1om9a_ appears in the current release, SCOPe 2.08
View in 3D
